- Cytochrome P450 2C9 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85488
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- CPC9, CYP2C, CYP2C10, CYPIIC9, P450-2C9, P450IIC9
- 0.1 ml (also 25ul)
- Unconjugated
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
- Cytochrome P450 2C9
- This antibody was developed against Recombinant Protein corresponding to amino acids: KEHQESMDIN NPRDFIDCFL IKMEKEKQNQ QSEFTIENLV ITAADLLGAG TETTST
- cytochrome P450 family 2 subfamily C member 9
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Lipid and Metabolism
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTST
Specifications/Features
Available conjugates: Unconjugated